NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318572_10061134

Scaffold Ga0318572_10061134


Overview

Basic Information
Taxon OID3300031681 Open in IMG/M
Scaffold IDGa0318572_10061134 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2055
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000222Metagenome / Metatranscriptome1536Y
F008962Metagenome / Metatranscriptome325Y
F013224Metagenome / Metatranscriptome273N

Sequences

Protein IDFamilyRBSSequence
Ga0318572_100611342F013224N/AMVIDPSPIITPAFQLLSAVASVGRVRTKSYVISRRFNALALGAVAADFAIKYLCTERADHLVGLVVFTILTARTLLLLCFETIEAEVLRRRLTCAVAFFACAVASVTSELVATGSLALVTLLPLVGIGLGCLGEASNAMVVRRRCVLAMGCIMALFAISTGAWGLVFKNTISDVEASIWSMIKSRDPPLPALASVVGFKLTITPTR
Ga0318572_100611343F008962GGAGGMTVWLPPWALIIALQVVTASASIGRLTTSYYIVSRAYNALALGAVAADFAIKYFVTGRGDDLTSGIVFTHRADDLTGLLVFSVLALRTLLILCIGSLDRSLLARRITCAVTFAVCVACTIVAQYIGIYAFRLVALLPAIGIGFGCLGEASDDGVVRRRCILALGCILAGFAFETSAWGLMFKNLLSDAGASAYNMLRYRDPPPWAPFSRGQSVWNDVMAGERHGNTELLAETPPSRSADLEGAAEHCPEWRASDR
Ga0318572_100611344F000222N/AGMRGVLNDALSIYFADATLASAFVARWCVGAKLETAGGVFQVREDEPTPRVGAGLHRTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.