| Basic Information | |
|---|---|
| Taxon OID | 3300031673 Open in IMG/M |
| Scaffold ID | Ga0307377_10379043 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1055 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Risofladan, Vaasa | |||||||
| Coordinates | Lat. (o) | 63.0472 | Long. (o) | 21.7116 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021062 | Metagenome / Metatranscriptome | 220 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307377_103790433 | F021062 | N/A | VYFFEPLEKEISVEDMQKIVDANEKVVKELKDGKD |
| ⦗Top⦘ |