| Basic Information | |
|---|---|
| Taxon OID | 3300031670 Open in IMG/M |
| Scaffold ID | Ga0307374_10162071 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1703 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Risofladan, Vaasa | |||||||
| Coordinates | Lat. (o) | 63.0472 | Long. (o) | 21.7116 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032840 | Metagenome / Metatranscriptome | 179 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307374_101620712 | F032840 | N/A | MSEYQVRTRLYEPPEAVRRIDSKLACFRITNAAHMRGEEMRRAFEQRLDGRTPDVVSAPVQGKRGPRIRLIA |
| ⦗Top⦘ |