NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307375_10322806

Scaffold Ga0307375_10322806


Overview

Basic Information
Taxon OID3300031669 Open in IMG/M
Scaffold IDGa0307375_10322806 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - TR-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)983
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010275Metagenome / Metatranscriptome306Y
F014903Metagenome / Metatranscriptome259Y

Sequences

Protein IDFamilyRBSSequence
Ga0307375_103228061F014903GGAGGVENDIKNVRFVEMTFDHTISFDIQEIADANNFVTNDIEAVECGKWAHLHITLKDGRIITEDGCTYGEVDMKWASEEHLYDENYNHVI
Ga0307375_103228062F010275AGGAGGMSNEINSTLMDNMRDNVHELWVIDGRPDLEDDCLQYCYDNIDRPVPITMIEFLSKHCYQALSTKDYEHMAREDDKWRMI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.