| Basic Information | |
|---|---|
| Taxon OID | 3300031668 Open in IMG/M |
| Scaffold ID | Ga0318542_10109014 Open in IMG/M |
| Source Dataset Name | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1344 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Puerto Rico: Rio Grande | |||||||
| Coordinates | Lat. (o) | 18.321 | Long. (o) | -65.8172 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061230 | Metagenome / Metatranscriptome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0318542_101090142 | F061230 | GGAG | MRTIGYFVAAAILILIGLATWTIPTTNAFTTSAGVDPFRMMTSATALPVAH |
| ⦗Top⦘ |