| Basic Information | |
|---|---|
| Taxon OID | 3300031665 Open in IMG/M |
| Scaffold ID | Ga0316575_10032121 Open in IMG/M |
| Source Dataset Name | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2055 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alabama | |||||||
| Coordinates | Lat. (o) | 30.2619 | Long. (o) | -88.2383 | Alt. (m) | Depth (m) | .05 to .07 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024001 | Metagenome / Metatranscriptome | 208 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316575_100321212 | F024001 | N/A | FLLDCLASKGSRKNKFAILGVEAPSRQGAKTPEYLDIPSFRNAAGRDASASKM |
| ⦗Top⦘ |