Scaffold Ga0307273_1051507

Overview

Basic Information

• Taxon OID: 3300031662
• Scaffold ID: Ga0307273_1051507
• Source Dataset Name: Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG04 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 642
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Huberarchaea → Candidatus Huberarchaeum → Candidatus Huberarchaeum crystalense (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water → Freshwater Rna Viral Communities From High-co2 Subsurface Aquifer At Crystal Geyser, Utah, Usa

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342
  • Depth (m): 800

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104462	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307273_10515072	F104462	AGG	MVQNFKNLLVGNNAAILLFEAPTTLTRIFFGIYIIAKKDPSFQVNVSFGNSQFLNPISLTYCRGYYEFTGPDISQGSIFVKTVNFAAGNICA