Basic Information | |
---|---|
Taxon OID | 3300031662 Open in IMG/M |
Scaffold ID | Ga0307273_1044312 Open in IMG/M |
Source Dataset Name | Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG04 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 712 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water → Freshwater Rna Viral Communities From High-co2 Subsurface Aquifer At Crystal Geyser, Utah, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah | |||||||
Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | 800 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002298 | Metagenome / Metatranscriptome | 573 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307273_10443122 | F002298 | N/A | MKNTKASVGAVPTLENKIKRGILAMTIKKIDNMKEKSDDIDRMNLEFYGMVGKTYGPQTIFEQHRTTIKIDTFRRDIGKRWAENMRKREEIYEIIDMLYELAKIETENLDAERSKQMSWAEVRKKIQEKMVKTLSR |
⦗Top⦘ |