NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307274_1045331

Scaffold Ga0307274_1045331


Overview

Basic Information
Taxon OID3300031661 Open in IMG/M
Scaffold IDGa0307274_1045331 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG05 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water → Freshwater Rna Viral Communities From High-co2 Subsurface Aquifer At Crystal Geyser, Utah, Usa

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)800
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016496Metagenome / Metatranscriptome246N

Sequences

Protein IDFamilyRBSSequence
Ga0307274_10453311F016496N/AMEDKKKENKYFFKKGNKYQQKGSAGLRYGGTTPVAKDKEKNLERLRRGWKPKTIVCKNITISDDEEAFANEFSKKVSEENDTYVDTFLIELAIAQILQVHRVYVYAKEKKISRDASRMIGTVLSTLREMNATKNARKEDNIKVTVNSDIMTLIQQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.