Scaffold Ga0307994_1124611

Overview

Basic Information

• Taxon OID: 3300031660
• Scaffold ID: Ga0307994_1124611
• Source Dataset Name: Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 890
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. BACL10 MAG-120910-bin24 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5958
  • Long. (^o): 78.1913
  • Depth (m): 18

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100634	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307994_11246112	F100634	GGA	MLLEFPLPKQPTAIIKLVVKDLVQRFRTSGTETISWFVAEGELVQFDENFDRLERSQMRHRMLHDLYQSQTTTVLIERFENFPEPHLDGNYCQFGGCSGIGDNVRPTADVRLK