Scaffold Ga0308005_10000186

Overview

Basic Information

• Taxon OID: 3300031656
• Scaffold ID: Ga0308005_10000186
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #67
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 23722
• Total Scaffold Genes: 29
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 22 (75.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5735
  • Long. (^o): 77.9231
  • Depth (m): 26

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036432	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308005_1000018619	F036432	GAG	MIKNRRIEPEIDEGTQKFFNKLILILIVLNVLIGVPTIYDMYFYEHTPKVYRDTSMIQTDET