Scaffold Ga0308018_10005643

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308018_10005643

Scaffold Ga0308018_10005643

Overview

Basic Information
Taxon OID	3300031655 Open in IMG/M
Scaffold ID	Ga0308018_10005643 Open in IMG/M
Source Dataset Name	Marine microbial communities from water near the shore, Antarctic Ocean - #282
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5141
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (76.92%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-68.5596	Long. (^o)	77.8957	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015741	Metagenome / Metatranscriptome	252	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308018_1000564312	F015741	N/A	MGCSGLPLVELIPPVFNFALGFYDHNDYYSKECLWYDEVRLNDDTKKWLLENNPPEIVSQDLAQVSRNNDLYKEVCKKDKGVADKLKDKANRVISKTSMATEERN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.