NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307514_10004041

Scaffold Ga0307514_10004041


Overview

Basic Information
Taxon OID3300031649 Open in IMG/M
Scaffold IDGa0307514_10004041 Open in IMG/M
Source Dataset NamePopulus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13637
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (52.94%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → Pezizomycetes → Pezizales → Morchellaceae → Morchella → Morchella sect. Distantes → Morchella importuna(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.6253Long. (o)-120.532Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036505Metagenome169Y
F081952Metagenome / Metatranscriptome113Y
F088003Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0307514_1000404110F036505N/AMAHVIQLSLGAFMSSLGVKGRTKSWEAHERDQQFGENESTDIGKSQRLRKEGNARINKVSAMRPGLAKIIEKVRISTYYESAETDLHIAENACCIEYADTWTSKRVY
Ga0307514_100040412F088003N/AVRNGKPPWSTKAFIGTVREIEHHHIVSSGIFADIFCDKGPWEWTKQTLKTLEEATESYMVEVIAEASI
Ga0307514_100040414F081952AGGMVNAPKKNFSPLPAGKYGKSTKHSTRRRHQANEGKSGLVAERVRALGALRSLRSKKKLAAEK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.