NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308012_10174640

Scaffold Ga0308012_10174640


Overview

Basic Information
Taxon OID3300031647 Open in IMG/M
Scaffold IDGa0308012_10174640 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #179
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)846
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5596Long. (o)77.8957Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002078Metagenome / Metatranscriptome596Y
F034953Metagenome / Metatranscriptome173N

Sequences

Protein IDFamilyRBSSequence
Ga0308012_101746401F002078AGGAMEMFMNQAWFQIAGEIVLVFTSITGALPDRWVRNVPFLGKVWVVFNWLAGNIFNNINHPRGMSAKAEVEKEIDDAKAEVRERI
Ga0308012_101746403F034953AGGMKQSQLTLLIKTYEPNTPVIITWRDAVDYSDEVTLSTLEVKEIFYDTIGFFLKVIDDYVIIAYNKADDKTYKGTGMIPCSLITDIRRLSDGYDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.