NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302118_10050581

Scaffold Ga0302118_10050581


Overview

Basic Information
Taxon OID3300031627 Open in IMG/M
Scaffold IDGa0302118_10050581 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - AG5_33.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2118
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)70.5467Long. (o)-122.9077Alt. (m)Depth (m)74
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014805Metagenome / Metatranscriptome260Y
F021015Metagenome / Metatranscriptome221N

Sequences

Protein IDFamilyRBSSequence
Ga0302118_100505812F014805AGGAGMGLYKSITTDAGSTLDYWDYGIIEVNTSAPNADQQNANVNIWGYTDVAYYNAGAPPVERWNTYSCGMVSGTDHYPYADLTGVSGEVTGTQRLGPDLPSNWSWTDNSVSGWMAASSDIRNGAQTWALNCVPAFSGATVTGQVYPD
Ga0302118_100505813F021015N/AMGLNLNYTKPDGQQSNYWKISRVEDWFQGTSGTQPGYMANVNSLGFTNESYRNAGAPSVEGNMFNCPYSGAVDMYSFTDLTGVSGEVTGSQRLGPPLPDGWDWAENGVSGWMQRSDDIRSGAYTWLKNCVPFFSGATDALAAGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.