Scaffold Ga0302121_10136195

Overview

Basic Information

• Taxon OID: 3300031626
• Scaffold ID: Ga0302121_10136195
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 708
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Veravirus → Roseobacter phage CRP-5 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 74.0136
  • Long. (^o): -139.5971
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067206	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302121_101361951	F067206	GAGG	MDNSIDFNNILLTHKGVDVSVIQHRDKDNPMDTQYQEIGIGEPSVDMPIIRYASTLDEFIDALQKARYKIEQ