NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302135_10276643

Scaffold Ga0302135_10276643


Overview

Basic Information
Taxon OID3300031625 Open in IMG/M
Scaffold IDGa0302135_10276643 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CBN3_surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)694
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)80.9595Long. (o)-132.1842Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010646Metagenome / Metatranscriptome301N

Sequences

Protein IDFamilyRBSSequence
Ga0302135_102766431F010646AGGAMKPIRSNELDFFNKIIENKFYDKRQALETEITSEAQKLADKKSPTMAKQCGVDGDLKKLSEADKKYKAFILSKIAVENKLLSDVREQMSKIESKLERMSKARGWSRSFDGYDATQDGAEYFYEKLNNACYDEAYKFVKANHKVYNDLRDKKSACEIILHTGSDINSTVSTLQKEMSTVNIDLPVPNHLLQLAVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.