| Basic Information | |
|---|---|
| Taxon OID | 3300031623 Open in IMG/M |
| Scaffold ID | Ga0302123_10441955 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 593 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Western Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 74.0136 | Long. (o) | -139.5971 | Alt. (m) | Depth (m) | 139 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062178 | Metagenome / Metatranscriptome | 131 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0302123_104419552 | F062178 | AGGGGG | MVDQAALVGEHLGWAVEDAVTLGDTATTHVVCTDAKMVLIETSHALDIGFGVAEAD |
| ⦗Top⦘ |