Scaffold Ga0302126_10071110

Overview

Basic Information

• Taxon OID: 3300031622
• Scaffold ID: Ga0302126_10071110
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1408
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 75.0007
  • Long. (^o): -150.0027
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023715	Metagenome / Metatranscriptome	209	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0302126_100711103	F023715	N/A	MVLLYFSYLIIVANILILSVGYVANIAFIGFFLSGLMAIGTDPIILILGALLGAGLVAKPYKFSVIYLWL