Scaffold Ga0308009_10000355

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0308009_10000355

Scaffold Ga0308009_10000355

Overview

Basic Information
Taxon OID	3300031612 Open in IMG/M
Scaffold ID	Ga0308009_10000355 Open in IMG/M
Source Dataset Name	Marine microbial communities from water near the shore, Antarctic Ocean - #127
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	36025
Total Scaffold Genes	58 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	40 (68.97%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Southern Ocean
Coordinates	Lat. (^o)	-68.5596	Long. (^o)	77.8957	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054160	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308009_100003551	F054160	AGGA	MKTFEKFHTDLLNNKVLSANEKVVYIICKSFENAPMGCRISHKYLMDRTKIKTRKTLIKILDRLTLFGMLAR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.