Scaffold Ga0307966_1018446

Overview

Basic Information

• Taxon OID: 3300031607
• Scaffold ID: Ga0307966_1018446
• Source Dataset Name: Saline water microbial communities from Organic Lake, Antarctica - #646
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4811
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (55.56%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Organic Lake
• Coordinates
  • Lat. (^o): -68.4561
  • Long. (^o): 78.1899
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000607	Metagenome	992	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307966_10184461	F000607	N/A	DRLLMRVNNSTGKGTSGMDKFSSKVHRVHMELGGKNLNSLRSETLFLEMLQGVSIVDGAVHTQKDAVKSNGGSLENVAKVFVLFLCGVSLVLRSGVLTVLALDKVDVTPMFAEVFRSMLSGVGGSTGGWRCC