NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308007_10146350

Scaffold Ga0308007_10146350


Overview

Basic Information
Taxon OID3300031599 Open in IMG/M
Scaffold IDGa0308007_10146350 Open in IMG/M
Source Dataset NameMarine microbial communities from water near the shore, Antarctic Ocean - #71
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)846
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameSouthern Ocean
CoordinatesLat. (o)-68.5735Long. (o)77.9231Alt. (m)Depth (m)26
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004606Metagenome / Metatranscriptome431Y
F008190Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0308007_101463501F008190N/ANFIYSDDALRVKTFLGNVPRSIECINYMDIFNKLTKNDFYQYEPSDAVVSSYLMRQLQNAISRNTSTTIFYVLGNLNTETVCGIQDYVGSLSNKPITYKIYHSPDITVNGTAELFDDIIEFE
Ga0308007_101463502F004606N/AMKTHRIFNKGQIVYCLLASHTNPNILLPVKGTILDSKWDPVNPLYQIRIIKFYDNMKFLKQHFFDMNFRHMFENRARKMILKSDDFKTTRALEDRLNDKDRERFYVVIESVMCTKTKVGLSGLFEKVQFYMISKNLKEIRDISTRPFFKGPLSLDSVKEF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.