Scaffold Ga0302116_1001287

Overview

Basic Information

• Taxon OID: 3300031597
• Scaffold ID: Ga0302116_1001287
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCM
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 15140
• Total Scaffold Genes: 19
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (36.84%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus danicus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 70.5467
  • Long. (^o): -122.9077
  • Depth (m): 24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005226	Metagenome	407	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302116_100128719	F005226	GAG	MPSNEHHKWLKKRDWPAVEGAMTDSDRDIDLLRSKYKERDEHGRLPHHWMAAKAQTHTHVLAQVGVQ