NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302131_1015735

Scaffold Ga0302131_1015735


Overview

Basic Information
Taxon OID3300031594 Open in IMG/M
Scaffold IDGa0302131_1015735 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB9_20m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3256
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)77.9995Long. (o)-150.0065Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006870Metagenome / Metatranscriptome363Y
F073140Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0302131_10157352F006870N/AMSHILLLVLSLILTNKASSFETKLSPQGSDKYNLSIKGDTKSSEKNLRDVFQNKVNEICGTRFEIISIKMDYESEEGAKINVLNGTFKCFVKSQM
Ga0302131_10157356F073140N/APNKKRISNWHTKPYGCHFMSNNKWLSMYYYLVYRDEGLGCLWESSNPNVRIKYSVTLKTFVNAPEQGRCILGD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.