| Basic Information | |
|---|---|
| Taxon OID | 3300031586 Open in IMG/M |
| Scaffold ID | Ga0315541_1008294 Open in IMG/M |
| Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6494 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Massachusetts | |||||||
| Coordinates | Lat. (o) | 42.722 | Long. (o) | -70.847 | Alt. (m) | Depth (m) | 1.9 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008068 | Metagenome / Metatranscriptome | 339 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315541_10082944 | F008068 | GAGG | MDEIIVAGEPCLVIRSPLIPRTLLCNSLLRPLLSRLKSAEEFVAFVSEPCIAPRDLDVVLITAFWPRCVFNQVSEETNRRPVQTIKPQHLMLVERELYMKLTKKSCLFGDFIDSLLLHNEDKRKVSELLNKVRSWIKDNKSYGLFFLTDVRGMEDFIDQTAGIFEIVVRAEIETEQDEPLLRFTIMKHPNIAEIDKKIEVAFEKGQPKRRRG |
| ⦗Top⦘ |