NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315541_1000355

Scaffold Ga0315541_1000355


Overview

Basic Information
Taxon OID3300031586 Open in IMG/M
Scaffold IDGa0315541_1000355 Open in IMG/M
Source Dataset NameSalt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)48617
Total Scaffold Genes79 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (69.62%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.722Long. (o)-70.847Alt. (m)Depth (m)1.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031354Metagenome / Metatranscriptome182Y
F059653Metagenome / Metatranscriptome133Y
F069660Metagenome / Metatranscriptome123Y
F091296Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0315541_100035543F069660GAGGMSSILKLLALIGGIVPIILTLIKEFETPGFGAEKKKAIMDAIALFYDKLAEGNVLPITKEKLLGIASGFIDIAVAFFNLVGWFKHGNPTVST
Ga0315541_100035564F031354AGGAMKTTFDINDILYPIINVDPVKATIDGRVYRNKKPLNSELQDIIIIPLSNYNGDEIINDATFMINCYCKNFNNGTPDITKLRAITDAVIAKIEAYNNTSKYYIFDIVSQILLPDVDQKSMSYVNLRINCFIEK
Ga0315541_100035566F091296GGAMVIKRYPHTATLSYYGAGTTSSIGIYTPGTLVTIGIICNAQPNSTKYIIGESGNMIGYNWFISSPLFAGAGSVPKAAKLTFFSKEHIILQLFEYQKHIEMKC
Ga0315541_100035567F059653GAGLIPKCRLPEHGVHNLNIMNNKESLQSLTEYENDNLLEKLLLDRGVATGGTYSAANAKDIDLCAADLYFTLAAHPDLKEGSFTIKYSGAQLIAMAKRILQKYDMDEPTVNGEAVW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.