Scaffold Ga0308134_1069274

Overview

Basic Information

• Taxon OID: 3300031579
• Scaffold ID: Ga0308134_1069274
• Source Dataset Name: Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 804
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 74.0136
  • Long. (^o): -139.5971
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038529	Metatranscriptome	165	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308134_10692741	F038529	N/A	MSLFKVAFALAAGSFVTSQADIVSDLTTSSVDEKRALEIKAGQFSDGVLQASEDMNMEKHVSVYADAETVIASLPAENEFVREALRESLTRLKRADETVLLQSIRTSQTASDSLASPVTGDFFSFMKGGQNFFAQAIRGFVDGGRYSEKLVRHVGERQGEILPVLQDTNEITGNVLKDCRLASAKSFDALKYDIYNNDVPKTPENAKALAYRLVEAVGETRHKFMRFVTEAADSIARDTQEKEEPAA