Basic Information | |
---|---|
Taxon OID | 3300031578 Open in IMG/M |
Scaffold ID | Ga0307376_11006253 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 502 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Risofladan, Vaasa | |||||||
Coordinates | Lat. (o) | 63.0472 | Long. (o) | 21.7116 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072852 | Metagenome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307376_110062532 | F072852 | N/A | RGCKVLGAAAHTSLTGYAFVAQEDTVVTVFTVGSTDSLAAYGLSTALKAGAYIVVPSGEVITAITLTSGSVIIYNQ |
⦗Top⦘ |