NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247727_10382120

Scaffold Ga0247727_10382120


Overview

Basic Information
Taxon OID3300031576 Open in IMG/M
Scaffold IDGa0247727_10382120 Open in IMG/M
Source Dataset NameBiofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1147
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Virginia
CoordinatesLat. (o)38.1667Long. (o)-79.633Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052012Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0247727_103821201F052012N/AYLWLSARVRATGSVGGPGGATSRTLDESASTGSITGALGGYASAWLAKRLVVYGDFLYIKVSPGDSKASVTDWRLGADYYFLRNAGLGVQYKYDKYSYDRGVLVSQLGGEIAYEGVQVLLSFRF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.