Basic Information | |
---|---|
Taxon OID | 3300031576 Open in IMG/M |
Scaffold ID | Ga0247727_10060041 Open in IMG/M |
Source Dataset Name | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4476 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Virginia | |||||||
Coordinates | Lat. (o) | 38.1667 | Long. (o) | -79.633 | Alt. (m) | Depth (m) | 9 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F034232 | Metagenome / Metatranscriptome | 175 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247727_100600419 | F034232 | GGGGG | MKKRPTREPYERPKVVRVRIVSGEMAVTGCKIRNGNVGPTLGCQRTACRTIGS |
⦗Top⦘ |