Scaffold Ga0247727_10013930

Overview

Basic Information

• Taxon OID: 3300031576
• Scaffold ID: Ga0247727_10013930
• Source Dataset Name: Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 13451
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (30.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location

• Location Name: USA: Virginia
• Coordinates
  • Lat. (^o): 38.1667
  • Long. (^o): -79.633
  • Depth (m): 9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019112	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247727_100139309	F019112	GGA	MRQCVLSFSMNFLSFKTVLIEHTHTQYVQARCKVGFNFTTVDTPYYIGGMCDPLIDLIDFEKKLPAHIKKSQYKKDKGSARVSAEYFITYEDADLPKQEEEGSFAKFVCRDPYEELLENDIELVKNLIKKTFGASKNQNDKIEHKIILEDRKLIKA