NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310915_10178522

Scaffold Ga0310915_10178522


Overview

Basic Information
Taxon OID3300031573 Open in IMG/M
Scaffold IDGa0310915_10178522 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1479
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020668Metagenome / Metatranscriptome222Y
F042116Metagenome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0310915_101785222F042116GAGGMGAVMFVLFKSALSSRPLFVNPSLVRVVVDGDQMGQGKICFDDQHSVTVQGTATEIAERLTGASEQTASPEG
Ga0310915_101785223F020668N/ARHPREPWPMIPTGAGKTATDRAAEAIEAAEKGFADEMGGTLGLSRAAKTTLMKTITAAIHDAVAEERQQLTWVL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.