NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310915_10025889

Scaffold Ga0310915_10025889


Overview

Basic Information
Taxon OID3300031573 Open in IMG/M
Scaffold IDGa0310915_10025889 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3610
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002802Metagenome / Metatranscriptome529Y
F059816Metagenome / Metatranscriptome133N
F064538Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0310915_100258895F064538GGAGGMTRGPRGEKRAIMSLWDDFIHRLEQDLAECRRDLELLESGQMQHRERKGDDPWVDTTQREIDWHKKTIGMYEGLIRKLRAEHGE
Ga0310915_100258896F059816AGGAVHVFESMTEPDLYGFTSDRSGNNLPPRGEWKYFKTIDMAVGETPRWGVSTEKALEAIEKDGFYLTTGQIRLEEREG
Ga0310915_100258898F002802N/ALASFRGMTEFVFEPPLRLARDVTVRTLDDAADFARTYVGPRLPRRRDRLVRRLEEISDDASARIAARAFRAWAIAEGLLAEET

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.