| Basic Information | |
|---|---|
| Taxon OID | 3300031569 Open in IMG/M |
| Scaffold ID | Ga0307489_11299260 Open in IMG/M |
| Source Dataset Name | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 527 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Alaska | |||||||
| Coordinates | Lat. (o) | 71.3731 | Long. (o) | -156.5049 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F074023 | Metagenome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307489_112992601 | F074023 | AGAAGG | MKIIDDYLKQDDVNALNNLHIEYAKVHWIGAASNPDTNPLTKMVHSTYNYVKEPALGATAWYNVRPLDPVWHNDILSYCDKYPINNLPEYTFIYYMRSPDSGGHLEIGGS |
| ⦗Top⦘ |