| Basic Information | |
|---|---|
| Taxon OID | 3300031555 Open in IMG/M |
| Scaffold ID | Ga0318466_11721674 Open in IMG/M |
| Source Dataset Name | Goal Fecal Pellet Co-assembly of all three pellet samples and three diluted pellet samples.(v2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 912 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.4204 | Long. (o) | -119.6671 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011633 | Metagenome | 288 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0318466_117216742 | F011633 | GAG | MKVLKEETWSISMDRARAFFREQEGITEESGRVFTYGSCRIELTELKPKGMGMWAAKRIKLRMEGEDEDVNAIYHRFFIQFLSTGG |
| ⦗Top⦘ |