NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318541_10034277

Scaffold Ga0318541_10034277


Overview

Basic Information
Taxon OID3300031545 Open in IMG/M
Scaffold IDGa0318541_10034277 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2536
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000792Metagenome / Metatranscriptome890Y
F002127Metagenome / Metatranscriptome591Y
F005673Metagenome / Metatranscriptome393Y

Sequences

Protein IDFamilyRBSSequence
Ga0318541_100342771F005673N/AMNSDREIADAIKAAQRLLWHTYDLPDAMKVVRLRKFVRSPIVQYALQRSSDTLLAITLRAVELVIADQSRTDREMIGRLWGILLNNPHLIQAMWPQNSPFGPS
Ga0318541_100342772F002127GGCGGVDLRKLLHQVETAPSGSPELDSAFESTFRSVPSHVTRSIDAAARLIETELPGWWWNCGHCALRNGASLYVPGSSQIRVNYPSAGIGPDFGPRPEHLRLLHDPKWGKLFDGGFHCDRAATVALAMLAVFLEAKIALTFVQPEASANKVIRSNK
Ga0318541_100342777F000792N/ADMRERVLLFCLLGLVLTVTMILVIAPGAVTWALALIE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.