NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318516_10009091

Scaffold Ga0318516_10009091


Overview

Basic Information
Taxon OID3300031543 Open in IMG/M
Scaffold IDGa0318516_10009091 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4733
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003674Metagenome / Metatranscriptome474Y
F009194Metagenome / Metatranscriptome321Y
F031310Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0318516_100090912F031310AGGAGGMITLIVTIVVIWTLVRIVQFVTGLWRSADAAGSPRIGVAQAA
Ga0318516_100090914F003674GGAGMPERWSDYLAIFMSALAVGYMVYEIDRRRRKLHDLFDVLGGEDAQLTTGLVGMVESGELQPYAGASLA
Ga0318516_100090917F009194GGAGMPNTRIFSGVTAEILSRMKEFGRAEHGIVYDPPEGPSSTATSQTPLGECVIEFVHDAAKAELTLTLVKKPWLLPEGLLWNGFSQTLERCRRET

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.