NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307380_11098302

Scaffold Ga0307380_11098302


Overview

Basic Information
Taxon OID3300031539 Open in IMG/M
Scaffold IDGa0307380_11098302 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - UN-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)626
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074771Metagenome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0307380_110983022F074771N/AMSEFILRGNRVLIDKPAKKDKSNKLDLILSDSDEKDLEKDAMKEWTHLNVCAVGIEVEDVKAGDKVYVKTGALHNAEIIDLNGSIKMMVTIHDIVMIWQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.