| Basic Information | |
|---|---|
| Taxon OID | 3300031539 Open in IMG/M |
| Scaffold ID | Ga0307380_10025838 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6887 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Risofladan, Vaasa | |||||||
| Coordinates | Lat. (o) | 63.0472 | Long. (o) | 21.7116 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064415 | Metagenome / Metatranscriptome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307380_100258386 | F064415 | N/A | MSSLGDLAEPFEHQLLTLGEAAQVLRIGRSLGYQLAHEYLNSGGTSGLPVVRLGEKCLRVPRWALMELATTGRVVRLCDAEAPVGGASDAR |
| ⦗Top⦘ |