NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307488_10088946

Scaffold Ga0307488_10088946


Overview

Basic Information
Taxon OID3300031519 Open in IMG/M
Scaffold IDGa0307488_10088946 Open in IMG/M
Source Dataset NameSea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2278
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)71.3731Long. (o)-156.5049Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042021Metagenome159Y
F043087Metagenome157N

Sequences

Protein IDFamilyRBSSequence
Ga0307488_100889461F042021GGAGMDFKDIAKQEELWKDIVLKGEMLTIKLLTEEAKKELEEKIANFLITRKEAIASNKFVFMFRDKEYTIDKDNVDIAIKNWASTKNIGKHRALLAYKKAETNAWIYKTLLDKKKTGMFKACKKLVLIGSGIYPYSMFDIHKKYKHIKQIGIEIDTNRAAIGRDLVSKSPAKNHIEIITHDGCTYDYGGINLGEDDLVFVSCDVDNKKVIDRVIATSKA
Ga0307488_100889462F043087AGGAMSVGFLTQYYRGLGHSQRIKFIAEKTAQYTDVVIMDQLFRPPIEYSVPHIAFLGDYTLPDINKVFQFIQQPAMINFRIKQFIETIEKHKVKVLVCEGFPFCRQQFAHEYFRYLEECKKRGIKIVISVRDFPWDEPHNNQLQDWVLYTQNIVCKYYAEYILVHGDKKLLPLVSDRTKQANSVQIIKDIEHLVQYTGYVCDEDQSIHKQRDNNIYVSTGLNKDEAVLIFKKIAEIAHHYPDHNFIMPIANKYNSMGGRKNKNIYLVEYVPELRTKLATCAAYITYGGYNATVEILKGEIPSILVPRQSGKKMEQFIRAFTFEPYDFYKVLTLQEFNNVKVVLDEVLNGYKPQPFKFNLKGASNTAKFLLEMHNGL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.