Scaffold Ga0308389_1079068

Overview

Basic Information

• Taxon OID: 3300031518
• Scaffold ID: Ga0308389_1079068
• Source Dataset Name: Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 788
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5387
  • Long. (^o): -110.798
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056638	Metagenome / Metatranscriptome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0308389_10790682	F056638	GGAG	MPSSWLRRWRDAYYTENPIVWLLAKTESELCLRQISAPEPAEAGSASSRLQLLKSDALYSDRYFHWADESEFERTLLAPWHLPSNRWLPLSDQLYLACASLVTMTALVIHYALAKSPVWVGAVGVGVVIVMFFAPMARPMLALHSLAQTLTAETPLHIGVSRLTPAHLVYGALLYGVGRI