NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308392_1001232

Scaffold Ga0308392_1001232


Overview

Basic Information
Taxon OID3300031517 Open in IMG/M
Scaffold IDGa0308392_1001232 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10443
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013092Metagenome / Metatranscriptome274N
F022362Metagenome / Metatranscriptome214N
F070715Metagenome / Metatranscriptome122N
F097406Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0308392_100123211F070715GGAGMRHRFTDEHGREYEVARISFARYHDLRDHGFDLAKWASEALARVVRPDTTTDNAQSQRFDYEEFVRILADGAVFRDRKTAEALLTVLCRDSLARHGITANDVFESLYGRSIWEAEVAFISRILDFFEGHPIMREILGAALKLLLSKVEQASVPTSSLTSGTLPATSA
Ga0308392_100123212F097406N/AMYESRLFHDHCHYGIIAAAIANAFRGSESPTIRVEDIFPDVAEYLERFGVRGDSELPLLTKDDLKSWLAQQKSERVVRASS
Ga0308392_10012326F013092GAGMNAILDNFFETLLRSRGVRLRLPNGSEIDAVVARRDSQSVSLGGQVAADTTTQCFVVRASDLPAGYWPRVADEIINVATSQRYIVVRATGGAHATTSSDPYGFLVRVWTRLAS
Ga0308392_10012328F022362GGAMIASLLDAVVNVLNGPPPVASVAASKTWAHYWVLARETPDVCVVTFVRSERERLSRSRFRFLLDVEVVRVRPYVDASSIEIVVNDVHSIASRLTSEEVLERDGIAYAFDSISFSDPLYEIEEVFDESSFVRASVTARYAVLESL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.