| Basic Information | |
|---|---|
| Taxon OID | 3300031481 Open in IMG/M |
| Scaffold ID | Ga0314816_1052291 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R1 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 548 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Surface Biofilm Microbial Communities From Soil Inoculated With Nitrogen-fixing Consortium Dg1, State College, Pennsylvania, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Pennsylvania | |||||||
| Coordinates | Lat. (o) | 40.7997 | Long. (o) | -77.8629 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016001 | Metagenome / Metatranscriptome | 250 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0314816_10522911 | F016001 | AGG | VWESAIAATVFSRRLDPIPSWASLLQVFALDAVETPSRLLPLVALVATLSSHCRHRPSAFRHRAWLASLEAAYLLEVLDLPATPSCPEISDEVRRSASPNPLRDPVP |
| ⦗Top⦘ |