NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170818_114370664

Scaffold Ga0170818_114370664


Overview

Basic Information
Taxon OID3300031474 Open in IMG/M
Scaffold IDGa0170818_114370664 Open in IMG/M
Source Dataset NameFir Coassembly Site 11 - Champenoux / Amance forest
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1661
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Mazerulles, Grand Est.
CoordinatesLat. (o)48.7585Long. (o)6.3578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030540Metagenome / Metatranscriptome185Y
F072713Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0170818_1143706642F030540GGAGMTSSRPDKAARSSSSAVALVECSVRVSPTLARLIRKSAEKEVSGTSAKDALLTAAGVQPGEVATLQRELQRASEESRQWREKAAREHGQLEQSKIAAAKWDNEKAVLRGDLRKATESLKGAQDQILTLEARIAELTTTLESRNKQLACSLSLSGLGDCAVAAIKALRDRLAKGEIQFSGDTAGDVEAMITNLERPEMRTLSKMLTRRAWRIHAIRWLLRVRAAS
Ga0170818_1143706643F072713N/AMKPRLIVAILVGLPLCAEAQEPSAAKAKADAQKFVKMIIGDKAKSQIYCDVVKLGEQIEETDPGDKKKADELYQQVDELTTKLGPEYFALMNELQDMDPDSEDGKEISSTLESLDKLCSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.