Basic Information | |
---|---|
Taxon OID | 3300031472 Open in IMG/M |
Scaffold ID | Ga0272437_1412780 Open in IMG/M |
Source Dataset Name | Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstone |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 557 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Victoria Land | |||||||
Coordinates | Lat. (o) | -77.9 | Long. (o) | 159.06 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066294 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0272437_14127801 | F066294 | N/A | LSWLTAHLYEEQISTGAIAVTQACCEPVLQSTTEQWGMHFAQTSGAVHLSWLTAHLYEEQIFTGAIAVTQACCEPVLQSTTEQWGMHFAQTSGAVLLSWLTAHLYEEQISTGAIAVTQACCEPVLQSTTEQWGMHFAQTSAAVHLSWLTAHLFEEQISICAIAGTQAYCEPVLQSTTEQWGMHFA |
⦗Top⦘ |