NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272439_1260181

Scaffold Ga0272439_1260181


Overview

Basic Information
Taxon OID3300031471 Open in IMG/M
Scaffold IDGa0272439_1260181 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sud
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)689
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-77.9Long. (o)161.58Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F094620Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0272439_12601811F094620N/AANQDVECELRIYCNYMQNDXAKXLSMKKFSDNFNTFSTISMISFYFNKDFHSRMSFDSDTTDYETTHQRIETRKINDIVTXISELLIFDHQQLKKIKQITEAQMNKHKQDVIYEVDDQVXLIFENIKITRSCKDLKDKQLNLYSITVKVEIFYRLQLSRSMKHIHSVFSSKYLRSSSNNLLSEQHSELSRSMIIEENEKHXKVDDILNFRQYRERLQYKVKXIEIDRDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.