| Basic Information | |
|---|---|
| Taxon OID | 3300031463 Open in IMG/M |
| Scaffold ID | Ga0272448_1363885 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 579 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5676 | Long. (o) | -110.8075 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011098 | Metagenome / Metatranscriptome | 295 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272448_13638851 | F011098 | N/A | AGGWWFQDHYTLSFQSPVRLRFQWPVVISQRIRSEGAEEAQADQHGRRLTAWQQYACRVFGPDCRLALAIQRAENPQGKCEIYHYNPDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNNGRYRQFMGQ |
| ⦗Top⦘ |