NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272448_1286428

Scaffold Ga0272448_1286428


Overview

Basic Information
Taxon OID3300031463 Open in IMG/M
Scaffold IDGa0272448_1286428 Open in IMG/M
Source Dataset NameHot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)725
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → unclassified Methanomassiliicoccales → Methanomassiliicoccales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Hot Spring Sediment Microbial Communities From Yellowstone National Park, Wy, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5676Long. (o)-110.8075Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019254Metagenome231Y

Sequences

Protein IDFamilyRBSSequence
Ga0272448_12864282F019254AGGMPSEKIHEALSHLQDDWPLRVLLSALAEGVAELAALLGKAEAQKLPPEFPTKIRAIEEEMHELSRLCQNPPLPQRHAKRRNVDDLPLF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.