NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0272425_1085303

Scaffold Ga0272425_1085303


Overview

Basic Information
Taxon OID3300031453 Open in IMG/M
Scaffold IDGa0272425_1085303 Open in IMG/M
Source Dataset NameRock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1536
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Victoria Land
CoordinatesLat. (o)-75.8Long. (o)159.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019584Metagenome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0272425_10853032F019584N/AFIEESVKATCRIIEMKMIDQSKSRDAVLTSIKENDLLIENYFLCHKFDHTSKKCLNKSFRINTLNDEFDHSLNFNSESDSKN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.