Scaffold Ga0272425_1021412

Overview

Basic Information

• Taxon OID: 3300031453
• Scaffold ID: Ga0272425_1021412
• Source Dataset Name: Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sud
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4585
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Victoria Land
• Coordinates
  • Lat. (^o): -75.8
  • Long. (^o): 159.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053677	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272425_10214122	F053677	GGTGG	MFSGCLTIDCLRSFCLVKSRGFAHLAALGLVSMMLHYVIVKTVELVGLTGMHKTGCSG